SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019985 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019985
Domain Number 1 Region: 224-385,447-509
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-39
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 512-696
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-35
Family cAMP-binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.62e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019985   Gene: ENSOCUG00000023146   Transcript: ENSOCUT00000028186
Sequence length 1076
Comment pep:known_by_projection chromosome:OryCun2.0:4:33764827:33777185:1 gene:ENSOCUG00000023146 transcript:ENSOCUT00000028186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPGLLAPRTTFLDTIATPFQSSHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKTRGGPDNWKETGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSTARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAAFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRTAAGG
NSSGPGDNCSSSGRSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTE
KIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRTHRIPKPLKQRM
LECFQATWAANNGIDTAELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLAL
RPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKA
NADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGSSAEVDTSSL
SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPR
LGGRGRPSRAGALREEAGPSTHPRTLEGLRLPPVPWNVPPELSPRVVDGIEDGCGSSDQP
QFSFRVGKPGSECSSRPSPVPESGLLTVPLGPSEARNTDTLDKLQQAVMELSEQVLQMRE
GLQSLRQAVQLMLEPHGEGRCPASPSGLLQPLRVDTDASSQAPRPPAGSVVTGTWPHPRG
PSPLMAPWPWGPPASQSSPWPRATALWASTSDSEPPGSEELCSEPSTPASPPPSEEAART
GPTEATSQAEATSTGEPPPGSGGLALPWDPHNLEMVLIGCHGSGSVQWSQEEGTGV
Download sequence
Identical sequences G1TSG9
ENSOCUP00000019985 9986.ENSOCUP00000019985 ENSOCUP00000019985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]