SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019988 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019988
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.71e-38
Family Co-chaperone p23-like 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019988   Gene: ENSOCUG00000022948   Transcript: ENSOCUT00000028343
Sequence length 160
Comment pep:novel scaffold:OryCun2.0:AAGW02082269:7227:7709:1 gene:ENSOCUG00000022948 transcript:ENSOCUT00000028343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKESAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Download sequence
Identical sequences G1TWX4
9986.ENSOCUP00000019988 9986.ENSOCUP00000021573 ENSOCUP00000019988 ENSOCUP00000021573 ENSOCUP00000019988 ENSOCUP00000021573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]