SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020017 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020017
Domain Number 1 Region: 1036-1307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-68
Family Protein kinases, catalytic subunit 0.0000316
Further Details:      
 
Domain Number 2 Region: 125-225
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000628
Family N-terminal PAS domain of Pas kinase 0.000011
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000020017
Domain Number - Region: 237-305
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000489
Family Heme-binding PAS domain 0.027
Further Details:      
 
Domain Number - Region: 341-383
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00454
Family Heme-binding PAS domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020017   Gene: ENSOCUG00000024545   Transcript: ENSOCUT00000024201
Sequence length 1350
Comment pep:known_by_projection scaffold:OryCun2.0:GL018993:46:29598:-1 gene:ENSOCUG00000024545 transcript:ENSOCUT00000024201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFEEDRRCLSGSLPVPAPAESPATPSPVDCRAPAMAHRHLSRKNGLSKLCQSRTALSE
DRWSSYCLSSLAAQNICTSRLYCPPTPEHADRLGSCSSASCCSLLRGFSAGWPTPLLPTP
VSNPNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQKLTQFFLKSDSHVVEALSEEH
VEADGRVAVVFGTVVDIVSRGGEKIAVSVWMKKVRQEHSLCCVVVLEPVERVSAWVSFQS
DGTITACDRLFAHLHGFVSAEEVVGQRITDLIPSVQLPPPGQQVPKNLKIQRSVGRARDG
TTFPLSLKLKSEAPSEAVDEGTAAPARGFLASVWVFCTISGLITLQPDGSIYGINHSFAL
MLFGYGKAELLGKNITFLIPGFYQYMDLADDSSVQLPDLAKCLDMSSDRGPGEAPLDPWP
AWDPANGAQDPRVYVATAGSHVLPPDETLSLGDSQDGSPETQAPLDVGGKLLPSLPPQPP
PGEDSMPTDRLPAPAARSLSTDEQSTQESPPDAGKQPLPENQQSIPGESPPGPGEQLLPK
DQPNIQEGSPPGPGDPSPAVGREEPAAPESPAEALLPESSSEPADAKPAAACEDSETALA
AQRWSSDVMCGPPREVPRDPGGLGGPGSPGSPNSLVDVTRPEPRAVGQPAEGALPAHQPR
FMSEWALHKPSQDSAPRPPGMTSVSLGTPTQDEPWQGVKDDREELQACLIKEQLCPPSFA
GAPDVSYIELMPRERLAVPLPVSRCSLRGRDMHGRADSSSARYALATDLPGVLEPVEAPE
PGVHSYSWNLKEAFFSDQMDRTSSHCSCAVSEPTETPCPSAGGSDSDVGGLSRQGSDVDA
RELLLLAGTCFRLGEGRRFQESRRTEPSEVSLVSSEHFEVSDSEGPSCLLPTSDASSEEA
QPAAEESRPSAQVTSTPVTPGAASLGRQIQEGTYSGSCYHRDGLRLSIQFEVKRVELQGS
ATLFCCWLVKNLLHSHQDSATRTRLLLASLPSSTHSMPELPGPSRGEVLRAKPWFEDPPK
PMELEGLAACEGAYAHKYSTLSPLGSGAFGFVWTAVDREQNKEVVVKFIKKEKVLEDCWI
EDPKLGRVTLEIAILSQVEHANIIKVLDVFENQGFFQLVMEKHGSGLDLFAFIDHHPSLD
EPLASYIFRQLVSAVGYLRSRGILHRDIKDENIVIAEDFSIKLIDFGSAAYLERGKLFHT
FCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLIFEENPFCELEETMEAAIHPPYLVS
QELMNLVSGLLQPAPQQRTTLEKLVTDPWVTQPVNLADYTWEEVCRINKPENGVLLPASL
GEQSLGEAGPGTPAPGEASSGQCAVGTPPR
Download sequence
Identical sequences G1TSK1
ENSOCUP00000020017 XP_008250386.1.1745 XP_008250387.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]