SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020096 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020096
Domain Number 1 Region: 106-353
Classification Level Classification E-value
Superfamily vWA-like 2.67e-86
Family Integrin A (or I) domain 0.000000000476
Further Details:      
 
Domain Number 2 Region: 350-438
Classification Level Classification E-value
Superfamily Integrin domains 3.71e-33
Family Integrin domains 0.00000386
Further Details:      
 
Domain Number 3 Region: 605-689
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.22e-23
Family Integrin beta tail domain 0.00000449
Further Details:      
 
Domain Number 4 Region: 2-56
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000942
Family Plexin repeat 0.0000369
Further Details:      
 
Domain Number 5 Region: 563-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 521-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000020096
Domain Number - Region: 490-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020096   Gene: ENSOCUG00000005579   Transcript: ENSOCUT00000023043
Sequence length 761
Comment pep:known chromosome:OryCun2.0:19:46700634:46761551:1 gene:ENSOCUG00000005579 transcript:ENSOCUT00000023043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNICTTRGVSSCQLCLAVSPMCAWCSDEALPVGSPRCDLRENLLQDNCAPESIEFPVSEA
QILEARPLSDKGSGDSSQVIQVSPQRIALRLRPDDSKTFSIQVRQVEDYPVDIYYLMDLS
YSMKDDLRSIQNLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALRNPCYDMK
TTCLPMFGYKHVLTLTDQVTRFNEEVKKQNVSRNRDAPEGGFDAIMQATVCDEKIGWRND
ASHLLVFTTDAKTHIALDGRLAGIVRPNDGQCHIGGDNHYSASTTMDYPSLGLMTEKLSQ
KNINLIFAVTENVFNLYQNYSELIPGTTVGVLSTNSSNILQLIVDAYGKIRSKVELEVRD
LPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGF
KDSLTVQVTFDCDCACQAHAEPHSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYSPS
QQDQCSPKEGQPICSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQ
CSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKC
PTCPDACTFKKECVECKKFERGVLHEENTCSRYCRDEIESVKELRDTGKDAVNCTYKNED
DCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGFALLLIWKLLITI
HDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences G1TSS7
ENSOCUP00000020096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]