SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020265 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020265
Domain Number 1 Region: 14-51
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000144
Family Ribosomal protein L36 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020265   Gene: ENSOCUG00000014954   Transcript: ENSOCUT00000014949
Sequence length 51
Comment pep:known_by_projection scaffold:OryCun2.0:GL019196:87704:87856:-1 gene:ENSOCUG00000014954 transcript:ENSOCUT00000014949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAALPAPPPALGFKTKGVLRRRCRDCRLVKRRGRWFVYCESNPRHKQRQM
Download sequence
Identical sequences G1TT95
ENSOCUP00000020265 9986.ENSOCUP00000020265 ENSOCUP00000020265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]