SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020365 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020365
Domain Number 1 Region: 241-542,580-757
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.24e-46
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number 2 Region: 719-867
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000942
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020365   Gene: ENSOCUG00000017228   Transcript: ENSOCUT00000031440
Sequence length 894
Comment pep:known_by_projection scaffold:OryCun2.0:GL018717:1714380:1722149:1 gene:ENSOCUG00000017228 transcript:ENSOCUT00000031440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APCPGEGPAQEGLQSLSRRLRVQEEEMELVKAALAEALRLLRLQGAPSSLQGSGAPAPAR
ASSPAAPPGLPPTCSPSLVSRGTQTDMEVEMEPSPGPPGLSNGPPVPQGGSEEPSWTQSE
GGGSSSSGAGSPGPPGILRPVQPPPRADTPRRNSSSSSSPSERPRQKLSRKAASSANLLL
RSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELPSG
PPPETLSLDWVYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQRHYR
GHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHVWDSETLLKLQEIGLGAFERGV
GALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMKLAEIKSTNESVLAVGFSPRDSSCIV
TSGKSHVHFWNWSGAAGVPANGTLARKQGVFGKYKKPKFISCFVFLPDGDILTGDSEGNI
LTWGRSLSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLLRDGTVLSGGGRDRRLVQWG
PGLVALQEAEIPEHFGAVRAIAEGLGSELLVGTTKNALLRGDLTQGFSPVIQGHTDELWG
LCTHPSQNRFLTCGHDRQLCLWDGEGHALAWSIDLKETGLCADFHPSGAVVAVGLNTGRW
LVLDTETREIVSDVTDGNEQLSVVRYSPDGLYLAVGSHDNMIYIYSVSSDGAKSSRFGRC
VGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKLLRNRYESRDREWATYTCVLGF
HVYGVWPDGSDGTDINSLCRSHDERVVAVADDFCKVHLFQYPCARAKAPSRVYGGHGSHV
TSVRFTHDDSYLVSLGGKDASIFQWRVLGAGGAGPAAATPSRTPSLSPASSLDV
Download sequence
Identical sequences G1TTJ4
9986.ENSOCUP00000020365 ENSOCUP00000014806 ENSOCUP00000020365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]