SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020862 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020862
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.41e-58
Family Ran-binding protein mog1p 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020862   Gene: ENSOCUG00000023954   Transcript: ENSOCUT00000031397
Sequence length 186
Comment pep:known_by_projection chromosome:OryCun2.0:19:10990644:10991960:-1 gene:ENSOCUG00000023954 transcript:ENSOCUT00000031397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAQQVDSVQTLSSESLALRTYCPEAWVLSGKQQVAKENQQVAK
NVTVHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPGNLSPPPWSLGDFEQLVTSLNLHDP
NIFGPQ
Download sequence
Identical sequences G1TUY4
XP_002719058.1.1745 9986.ENSOCUP00000020862 ENSOCUP00000020862 ENSOCUP00000020862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]