SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020981 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020981
Domain Number 1 Region: 23-110
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000207
Family cAMP-binding domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020981   Gene: ENSOCUG00000025973   Transcript: ENSOCUT00000026528
Sequence length 164
Comment pep:known_by_projection chromosome:OryCun2.0:12:93228456:93237601:-1 gene:ENSOCUG00000025973 transcript:ENSOCUT00000026528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPFQFLDSPEWD
SLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALN
DRVYIGKRYHYDIRLPNFYQMSSPERPKSPLTEHFRNSRRYCDK
Download sequence
Identical sequences G1TV98
ENSOCUP00000020981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]