SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021015 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021015
Domain Number 1 Region: 175-320
Classification Level Classification E-value
Superfamily TPR-like 4.2e-22
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 2 Region: 6-93,128-157
Classification Level Classification E-value
Superfamily FKBP-like 5.61e-16
Family FKBP immunophilin/proline isomerase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021015   Gene: ENSOCUG00000027395   Transcript: ENSOCUT00000029037
Sequence length 328
Comment pep:known_by_projection chromosome:OryCun2.0:19:13651799:13660409:-1 gene:ENSOCUG00000027395 transcript:ENSOCUT00000029037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAALLLNVEGVKKTILHGGTGDLPSFLTGSRVTFHFRTTKCDDERTVIDDSKQVGQPMH
IIIGNMFKLEVWETLLMSMRLHEVAEFWCDTIHTGVYPILSRSLRQVAEGKDATEWHVHT
CGLANMFAYHSLGYEDLDELQKEPQPLIFIIELLQVEAPSEYQRETWNLNNDERLQAVPV
LHGEGNRLFKLGRYDAACTKYQEAIVCLRSLQTKEKPWEVPWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGMVKAYYVRARAHAEVWNAAEAKADLEKVLELDPSMQKA
VRRELRLLESRMADKQEEERLRCRSMLG
Download sequence
Identical sequences G1TVD2
9986.ENSOCUP00000021015 ENSOCUP00000021015 XP_002718891.1.1745 ENSOCUP00000021015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]