SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021497 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021497
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.57e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000135
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021497   Gene: ENSOCUG00000014904   Transcript: ENSOCUT00000028059
Sequence length 863
Comment pep:known_by_projection chromosome:OryCun2.0:2:139861492:139942118:-1 gene:ENSOCUG00000014904 transcript:ENSOCUT00000028059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKSGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSESMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMTMNSIFDSSGEVAVSEKSDFLFTKLKEEPEELAQLAPTAGDAIISLDFGSQS
FEDSSAYSKAILPPGQPWAAEMRTHGALSEAGSLPAFTVPQVAAPGSTTPSASSSSSCST
PSSPGDYYTALEDDLKIEMIEKLFAMDTEAKDQCSAQTDFNELDLETLAPYIPMDGEDFE
LSPICPEEPLVPESPQPTPQQCFSTMTTIFQPLGPTAAPSPFLLEKYPPPLEGKKTEPEH
HPMSSIFFDAGSKTALSPCCGQACTPLSSMGGRSNTQWPPDPPLHLGPTDWPAGNQHTEP
LGASPLGPPVAVPNVSMFKTRSAKGFRPQAPDAMSPAVVALSSKLKLKRQLEYEKQAFQD
GDPPGSNASHLWKRMKSLQGGGCPLTPDRGLDANGPSDEFMQTPARGLGQPLRHLPPPPS
TLSPGDNCSSGLIPQCFAPQYQDYNLPLAHKMSGLASQLLGPSFEPYLLPELTRYDCEVN
VPVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences G1TWQ0
ENSOCUP00000021497 XP_008252675.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]