SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021530 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021530
Domain Number 1 Region: 404-433,466-569,691-806
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-52
Family Phosphate binding protein-like 0.000000145
Further Details:      
 
Domain Number 2 Region: 223-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000353
Family L-arabinose binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021530   Gene: ENSOCUG00000021974   Transcript: ENSOCUT00000026422
Sequence length 1251
Comment pep:known_by_projection scaffold:OryCun2.0:GL018989:60599:70902:1 gene:ENSOCUG00000021974 transcript:ENSOCUT00000026422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPALLSPQDPAVDMGGALGLALLLTWLLGAWAGLGLGQGEQAVTVAIVFGSSGLPQAQAR
PRLTSQNFLDLPLEIRPLTVGVNNTNPSSLLTQICSLLGAARVHGIIFEDNVGTEAVAQL
LDFISSQTHVPIFSISGGSAVVLTPKVPVQAHVPWSLGSRVAFSVFIVGNFEHTPKRITP
RTPTHPGHYAFPPRVRIPPPAPQWQPCCLDQRRPTRGSGLPRHLTQRLLRQVDAPVLVAY
CSRDEAEVLFAEAAQAGLVGPGHVWLVPSLALGSTDTPPAAFPVGLISVVTESWRLSLRQ
KIRDGVAILALGAQSYRRQHGALPAPAGDCRGHAGPVSPAREAFYRHLLNITWEGRDFSF
SPGGYLVQPTMVVIALNRHRLWEMVGRWEHGVLHMKYPVWPRYSASLQPVVDSRHLTVAT
LEERPFVIVESPDLGTGGCVPNTVPCRRQSSHTFSSGDAAPYTKLCCKGFCMDILKKLAK
AVKFSYDLYLVTNGKHGKRVRGVWNGMIGECIYKRADMAIGSLTINEERSEIVDFSVPFV
EGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYSQNLAR
GKKSGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLA
AFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQ
RSVEDALTSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSH
WKRAIDLALLQFLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGL
ALLVFAWEHLVYWKLRHSVPSTSQLDFLLAFSRGIYSCFSGVQSLPSPARPPSPDLTAGS
AQASVLKMLQAARDMVTTAGVSSSLDRATRTIESWGSGRRAPPPSACSAPGPAPCPCSPT
PRALPEPSPRVWDTPGGSRAALGRRGPQPPCRPPTPRPQPLDVPRVSCRPTWEVRWPVPA
GRGGRRFSASERRTWPERPLSPARCRYSSFPRADRSGRPILPLFPEPPEPEDLPLLGPEQ
LARREALLRAAWAQDRRPRHASLPSSVAEVFARPCPGPVGGSCTACLCPSGRLPCGRLVQ
AQSMRLPSYREACLEGVPTWRPRQHTCLHAHAHLPFCWGAVCPHLPPCVSHSPWLTGAWG
PLAYGGSRTLGLSTGYRDSGGPREAARGACGTQDFPGPCTWRRISSLESEV
Download sequence
Identical sequences G1TWT2
ENSOCUP00000021530 9986.ENSOCUP00000021530 ENSOCUP00000021530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]