SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022145 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022145
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-103
Family Carbonic anhydrase 0.0000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022145   Gene: ENSOCUG00000027920   Transcript: ENSOCUT00000032021
Sequence length 264
Comment pep:known_by_projection chromosome:OryCun2.0:5:22255030:22263603:1 gene:ENSOCUG00000027920 transcript:ENSOCUT00000032021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIVSSQAVYSPGLQPLELSYEACTSLS
IANNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKRRDAGSEHTVDGKSFPSEL
HLVHWNARKYSTFGEAASAPDGLAVVGVFLETGNEHPSMNRLTDALYMVRFKGTKAQFSC
FNPKCLLPSSRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMEKFRSLLFTSEDDER
VHMVNNFRPPQPLRGRVVKASFRA
Download sequence
Identical sequences G1TYI1
XP_008255618.1.1745 ENSOCUP00000022145 9986.ENSOCUP00000022145 ENSOCUP00000022145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]