SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022206 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022206
Domain Number 1 Region: 99-502
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.29e-52
Family Glycerol-3-phosphate transporter 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000022206
Domain Number - Region: 39-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0628
Family Kringle modules 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022206   Gene: ENSOCUG00000024091   Transcript: ENSOCUT00000023266
Sequence length 542
Comment pep:known scaffold:OryCun2.0:GL018717:1367437:1388986:1 gene:ENSOCUG00000024091 transcript:ENSOCUT00000023266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGPFQFLHVALLGFPILGMANHNLLQIFTATTPSHHCRPPPNASAGPW
VLPVNQNGQTERCLRFVHPPNASLPNDTQGATEPCLDGWVYNSTRDTIVTEWDLVCSSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRKPILTCCYLLLAASGSSTAFSPTLPIYMVFR
FLCGFSISGISLSTVILNVEWVPTKMRAITSTAIGYCYTIGQFILPGLAYAIPQWRWLQL
TVSVPYFIFSLLSWWIPESIRWLVLAGKSSKALKILRRVATFNGKKEEGEKLSLEELKLS
LQKDISLAKAKYSTADLFRTPILRRVTLCLSLAWFATGFAYYSLAMGVEEFGVNIYILQI
IFGGVDIPAKFITILSLSYLGRHITQGAALILAGAAILSLIFVPMDMSLLRTILAVFGKG
CLSGSFSCLFLYTSELFPTVIRQTGMGISNVWARVGSMISPLVKITGEIQPFIPNIIYGT
VALLGGSAALFLPETLNQPLPETLEDMENWFLQSKKLKQEPEAEKASQRIPLQPSGPGVD
RS
Download sequence
Identical sequences Q8HY24
9986.ENSOCUP00000022206 NP_001075590.1.1745 XP_008272547.1.1745 ENSOCUP00000022206 ENSOCUP00000022206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]