SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022540 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022540
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.83e-31
Family Nucleoplasmin-like core domain 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022540   Gene: ENSOCUG00000021756   Transcript: ENSOCUT00000025238
Sequence length 209
Comment pep:known_by_projection scaffold:OryCun2.0:GL018798:615160:629633:-1 gene:ENSOCUG00000021756 transcript:ENSOCUT00000025238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSSISSTAEKAVRTLLWGCELNQEKRTWTWKPQVEGKESCRLWLNTICLGEKAKEEVN
RVEVLPGAGQEDRKASPVTIASLQASVLPMVAMADLELSPSITFQLRAGSGPVFISGKEC
YGSPKNTWEGERRKAQAVETAETTQEASISLEESPVKPAKRQAPLKQSSVAKKKKLAKEE
EAVRSSLREKSPGHKAKSTPRPKKPASKK
Download sequence
Identical sequences G1TZL7
9986.ENSOCUP00000022540 ENSOCUP00000022540 ENSOCUP00000022540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]