SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022695 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022695
Domain Number 1 Region: 276-418
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-41
Family Mannose 6-phosphate receptor domain 0.000000612
Further Details:      
 
Domain Number 2 Region: 122-271
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-40
Family Mannose 6-phosphate receptor domain 0.000000173
Further Details:      
 
Domain Number 3 Region: 578-713
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-38
Family Mannose 6-phosphate receptor domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1466-1597
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-35
Family Mannose 6-phosphate receptor domain 0.00000016
Further Details:      
 
Domain Number 5 Region: 1018-1169
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.71e-33
Family Mannose 6-phosphate receptor domain 0.00082
Further Details:      
 
Domain Number 6 Region: 1173-1313
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.9e-33
Family Mannose 6-phosphate receptor domain 0.00016
Further Details:      
 
Domain Number 7 Region: 426-569
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.67e-32
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 8 Region: 714-875
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-31
Family Mannose 6-phosphate receptor domain 0.0018
Further Details:      
 
Domain Number 9 Region: 1602-1747
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 1939-2076
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.89e-29
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2083-2230
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.02e-28
Family Mannose 6-phosphate receptor domain 0.00093
Further Details:      
 
Domain Number 12 Region: 1319-1458
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.32e-28
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 13 Region: 1-119
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-23
Family Mannose 6-phosphate receptor domain 0.0000052
Further Details:      
 
Domain Number 14 Region: 1754-1847,1896-1939
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.05e-21
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 15 Region: 878-1028
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-18
Family Mannose 6-phosphate receptor domain 0.0035
Further Details:      
 
Domain Number 16 Region: 1846-1894
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-16
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022695   Gene: ENSOCUG00000008785   Transcript: ENSOCUT00000023385
Sequence length 2450
Comment pep:known_by_projection chromosome:OryCun2.0:12:149773364:149860242:1 gene:ENSOCUG00000008785 transcript:ENSOCUT00000023385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSYTWEAVDTKNNILYKINVCGNVAAAPCGPXXXXXXXXLFVLVLLHTGDSALRSASRS
LLEFNTTVSCGPRGAGHRVQSSISFRCGKTLGTPEFVTATECVHYFEWKTTAACRKDTFK
ANKEVPCYAFDGELRKHDLNPLIRMSGGYLVDDSDPEASLFINVCRDIDTLRDPSPLLRA
CPHGTAACLVRGDQAYDVGQPKEGLKLMSRDRLVLIYVKEGAEKPDFCDGHSPAVTITFV
CPSERREGTLPKLTAKSSCRYEVEWVTEYACFRDFLESSTCSLTSQQHDVTVNLSPLAQH
PGSHYTADGGEYTFYLNICAGTGAPICNNKDAAVCQVKANTSQLKVAGKYQNQTRRYSDG
DLTLIYFGGEECSSGFQRMSVINFECNETAENDGRGTPVFTGEMDCSYFFTWDTKYACIS
EKDGLPCGAIDGKRRYDLSALVRHSESERNWEAVDGSQAGAEKKHFFINICHRVLQEGQA
RGCAEEAAVCAVDKFGSKNLGKFISPPTKEKGSLQLFYSDGDDCGDNKKISTNITLVCKP
GDLESPPVLMASGDDGCSYEFEWHTAAACVLSKTEGENCTVIDSQAGFSFNLSPLTKRNG
AYRVETAKYDFYINVCGPVAAASCPPDAGACQVSKSDRKSWNLGVSNAKLSYYDGMIQLS
YRDGTPYNNARRTPRATLITFLCDRDADVGFPEYQEEDNSTYNFRWYTSYACPQEPLECV
VTDPLTLEQYDLSSLAKSETSRGRNWYALDNSGERMSWRKYYINVCRPLNPVPGCDRFAA
ACQMKFQRDQDSYTEVASIKNLGVAKTGPVVEETGSLLLEYVNGSACTTSDGRQTTYTTR
IHLVCSRGNLNTHPIFSLNWECVVSFLWNTEAACPVQMMIDTDQTCSIRDPNSGFVFNLN
PLNSSQGYVIPAIGKTFVFNVCGTMPVCGKVGSQPASGCEAGTHTEDLKNLKPEWPVVER
SLQLSTEGFLTLTLKGSSSSRATGASFVIRFVCNDDVYPGTPKFLHQDIDSRRGVRNTYF
EFETALACVPSPVDCQVTDPAGNEYDLSALSAVRKPWTAIDSSTDGKKRTFYLSVCNPLP
YIPGCHGSAVGSCLVSEDNSWNLGVVQISPQAAANGSLTIVYVNGDKCGNQRFSTRIMFE
CAQVTGSPVFQLMDDCEYVFVWRTVEACPVVRVEGDNCEVTDPRHGNLYDLKPLGLNDTM
VSAGEYNYYFRVCGKLSSDICPTIDKSKAVSSCQEKRGPQGFQRVAGLLTQKLTYENGLL
KMNYTGGETCHKVYQRSTTIFFYCDRSTQKPVFLKETSDCSYLFEWRTQHACPPFHLTEC
SFKDDDGNSFDLSPLSRYSDNWEAVTRTGATEXXXSRGVVSVAPSRVADPCPPEAAACLV
GGARPVNLGRVKDSPQWKDGITTLKYVDGDPCPDGIRRKSTTIRFTCSENQANSRPLFIS
AVEDCEYTFSWPSASACPVKNNVHEDCQVTNPSTGHLFDLTSLSGRAGFTAAYSEKGLVY
MSICGENENCSPGVGACFGQTRISVGRASKRLSYVDQVLQLVYEDGSPCPSKSGLTYKSV
ISFVCRPESGPTNRPMLISLDKQTCTLFFSWHTPLACEQVTECSVRNGSSVIDLSPLIHR
TGGYEAYDESEDDSSDTYPDFYINICQPLNPMHGVACPAGAAVCKVPVDGSPIDIGRVTG
PPIFNPVANEIYLNFESTTPCQADKHFNYTSLIAFHCKRGISMGTPKLIRTSECDFVFEW
ETPIVCPDEVRTDGCALTDEQLLYSFNLSSLSRNTFKVTRDSRTYSVGVCTAAAGLDEGG
CKDGGVCLLSGTKGASFGRLASMQLDYRHQDEAVILSYMNGDPCPPETDEGDPCVFPFTF
KGKSYEECVVENRAKLWCSTTSDYDRDHEWGFCRQSNSHRTSTIIFRCDEDEDIGKPRVL
SEVRGCEVTFEWKTKVVCPPEKMECKFVQKHKTYDLRLLSSLTGSWFFVHEGATYFINLC
QRIYKGPLDCSERASICKKSPTGQVQALGLVHTQKLDVVDDKVTITYSKGYPCGENKTAS
SVIELTCAKTVGKPTFTRFDIDSCTYYFSWYSRAACAVKPQEVHMENGTIINPINGRSVS
LGDIYFKLFSASGDMRANGDAYLYEIQLSSLTSPTHPGCSGASVCQVKPNDQRFSRKVGT
SERTKYYVQDGDLDVVFTSSSKCGKDKSKSVSSTIFFHCDPLVQDGVPEFSHETADCQYL
FSWYTSAVCPLSDFDSENTEQDEQEHRGLSERSQAVGALLSLLLVALTGCLLTLLLYKKE
RRETVMNKLTSCCRRSSSVSYKYSKVNKEEETENETEWLMEEIQLPAPRPGKEGQENGHV
TTKAVRAEALSSLHGDEQDSEDEVLTIPELKVAPGRGARAGRLPAGRASLSARSPGGRED
DRVGLVPGEKLRKGKARPVPPKPTTATATAAAAAQLASFHDDSDEDLLHI
Download sequence
Identical sequences G1U018
9986.ENSOCUP00000022695 ENSOCUP00000022695 ENSOCUP00000007599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]