SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022955 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022955
Domain Number 1 Region: 47-222
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 7.72e-45
Family Peptidyl-tRNA hydrolase-like 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022955   Gene: ENSOCUG00000006894   Transcript: ENSOCUT00000029433
Sequence length 231
Comment pep:known_by_projection scaffold:OryCun2.0:GL018699:19998:21583:1 gene:ENSOCUG00000006894 transcript:ENSOCUT00000029433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGPGSGVNRGGMAPPGLLRSWLGQSRAMSLAMSRCVLEPRPPGKRWLVAGLGNPGLPG
TRHSVGMAVLGQLARRLGVAESWARDPRCAADLALAPLGDAQLVLLRPRRLMNSNGRSVA
RAAELFGLTADAVYLVHDELDKPLGKLALKLGGSARGHNGVCSCISCLNSSAMPRLRVGI
GRPATADAVQAHVLGRFSPAEQELLPLLLDRATDLLLDHIRERSQGPAVGP
Download sequence
Identical sequences G1U0S4
XP_002720515.1.1745 ENSOCUP00000022955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]