SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023192 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023192
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.7e-33
Family Nucleoplasmin-like core domain 0.0000127
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000023192
Domain Number - Region: 151-234
Classification Level Classification E-value
Superfamily HRDC-like 0.0102
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023192   Gene: ENSOCUG00000026724   Transcript: ENSOCUT00000024087
Sequence length 238
Comment pep:novel scaffold:OryCun2.0:AAGW02082565:3013:3897:-1 gene:ENSOCUG00000026724 transcript:ENSOCUT00000024087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQLTVSLGGFEITPPVVVKLLSISGKRSAPGGGSKVPQ
KKVKLAAEEETEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSTPKSKGQESFKKQEKTPK
TPKGPTSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences G1U1F7
9986.ENSOCUP00000023192 ENSOCUP00000023192 ENSOCUP00000023192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]