SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023296 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023296
Domain Number 1 Region: 168-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-80
Family Eukaryotic proteases 0.00000000339
Further Details:      
 
Domain Number 2 Region: 50-164
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-32
Family Kringle modules 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023296   Gene: ENSOCUG00000003155   Transcript: ENSOCUT00000029709
Sequence length 433
Comment pep:known chromosome:OryCun2.0:18:13595218:13601355:-1 gene:ENSOCUG00000003155 transcript:ENSOCUT00000029709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLVCLLLCALVVSDSEGSHELHGVSDASNCGCLNGGTCVTYKYFSNIWRCNCPKKFQ
GEHCEIDTLKTCYHGDGHSYRGKANTDIMDRPCLAWNSANVLTKTYHAHRPDALQLGLGK
HNYCRNPDHQRRPWCYVQVGLKQLIQECKVHDCSSGKKPALPPGKLEFQCGQKALRPRFK
IIGGEFTIIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINHQKKEDYIVY
LGRSRLNSMTPGEMKFEVEQLILHEGYRADTLAHHNDIALLKILSNNGQCAQPSRSIQTI
CLPPWNADPNFGTSCEITGFGKENSTDYLYPEQLKMTVVKLVSYQECQQPHYYGSEVTTK
MLCAADPQWETDSCQGDSGGPLVCSVQGRMTLTGIVSWGRGCALKNKPGVYTRVSRFLPW
IRSHIGEENGLAL
Download sequence
Identical sequences Q8MHY7
NP_001075480.1.1745 XP_008268125.1.1745 ENSOCUP00000002743 9986.ENSOCUP00000023296 ENSOCUP00000023296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]