SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023312 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023312
Domain Number 1 Region: 33-156
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 9.58e-23
Family Extradiol dioxygenases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023312   Gene: ENSOCUG00000008902   Transcript: ENSOCUT00000028977
Sequence length 159
Comment pep:known_by_projection chromosome:OryCun2.0:X:33420825:33440157:1 gene:ENSOCUG00000008902 transcript:ENSOCUT00000028977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLPFRLPVRMSGRTLEKQSWSNSSQTPSPSLIHRLDHIVMTVKSIQDTTKFYSKILGM
EVVTFKGDRKALCFGEQKFNLHEVGKEYEPKAAHPIPGSLDICLITEVPLEAMIQRLKAY
DVSIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences G1U1S3
XP_002719944.1.1745 ENSOCUP00000023312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]