SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023394 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023394
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-50
Family Phosphate binding protein-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.57e-23
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000023394
Domain Number - Region: 676-769
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0549
Family Voltage-gated potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023394   Gene: ENSOCUG00000016738   Transcript: ENSOCUT00000029638
Sequence length 1135
Comment pep:known_by_projection chromosome:OryCun2.0:1:11180155:11399490:1 gene:ENSOCUG00000016738 transcript:ENSOCUT00000029638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPLPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APSATSRAPDGSRAGAQRDEPEPGTWRPPAPSPGARWLGSALHGRGRLGARKPGEGAGAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LSSTKDLVSFLQVQLESVKNSTPTIVMFGCDMESIRQIFEITTQFVVTPSELHWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLNPMTNDSSILDSLFNSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEFLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKMVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRALNTSFGEEKQQRFKTKRVEKSKINIWTCKNEVDSEMSL
FLRSNVAPRQLMVWNTSSLSHDNQRKYIFSDEGGQNQLGIRTPQDIPLPPRRRELPASLT
TNGKADSVNVARNSVMQELSELEKQIRVIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences G1U202
ENSOCUP00000023394 ENSOCUP00000014386 9986.ENSOCUP00000023394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]