SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023674 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023674
Domain Number 1 Region: 75-131
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-17
Family Fibronectin type II module 0.0041
Further Details:      
 
Domain Number 2 Region: 44-86
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000914
Family Fibronectin type II module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023674   Gene: ENSOCUG00000028145   Transcript: ENSOCUT00000030460
Sequence length 131
Comment pep:known_by_projection scaffold:OryCun2.0:GL019089:79478:88777:1 gene:ENSOCUG00000028145 transcript:ENSOCUT00000030460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLEVLLVWASLLHGAASTPYKGQHPPTADSIIHFPEMEDGRCVFPFQYRKETFHDCI
SFNARHKWCSLNETYMGYWKYCTKADFAKCVFPFWFRRMIYWNCTQDGNDFGKKWCSLTQ
NFNKDQLWKYC
Download sequence
Identical sequences G1U2S1
XP_008250822.1.1745 ENSOCUP00000023674 ENSOCUP00000023674 9986.ENSOCUP00000023674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]