SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023761 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023761
Domain Number 1 Region: 1-210,248-350,384-471
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.04e-74
Family Arylsulfatase 0.0000991
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000023761
Domain Number - Region: 338-376
Classification Level Classification E-value
Superfamily ALDH-like 0.00553
Family ALDH-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023761   Gene: ENSOCUG00000021784   Transcript: ENSOCUT00000031836
Sequence length 483
Comment pep:known_by_projection scaffold:OryCun2.0:GL019360:50893:70641:-1 gene:ENSOCUG00000021784 transcript:ENSOCUT00000031836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWGDLGVNGEPSRETPNLDRMAAEGMLFPNFYSANPLCSPSRAALLTGRLPIRNGFYTT
NAHARNAYTPQEIVGGIPDSELLLPELLREAGYVSKIVGKWHLGHRPQFHPLKHGFDEWF
GSPNCHFGPYDNRARPNIPVYRDWEMVGRFYEEFPIDLKTGEANLTQIYLEVLEALLRRD
PSPPLTQAWRPLPSTHRHADPSSPHTGVDTPAPHTQVWRPLLSLEALRPLPCTDTGVETP
PSGLRRLTPVPPTGGSNGPFLCGKQTTFGGVREPAIAWWPGHIPAGQVSHQPGSLMDLFT
TSLALAGLKPPSDRVIDGLDLLPAALHGRLTDRPVFHYRIRGPTAGAAIASHIGIDKIAF
TGSTENVGEWQSQAQGINFCPGQDVAGVTTHTQEEHTKLPLIFHLGRDPGERYPLSFASA
EYQEALRRVGPVVQQHQEALVPGEPQLNVCNQAVMNWAPPGCEKLGKCLRAPESVPEKCS
WPH
Download sequence
Identical sequences G1U304
9986.ENSOCUP00000023761 ENSOCUP00000023761 ENSOCUP00000023761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]