SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024177 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024177
Domain Number 1 Region: 63-550
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-143
Family ALDH-like 0.000000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024177   Gene: ENSOCUG00000025121   Transcript: ENSOCUT00000022147
Sequence length 567
Comment pep:known_by_projection chromosome:OryCun2.0:20:30932223:30957403:1 gene:ENSOCUG00000025121 transcript:ENSOCUT00000022147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVVAAAVRARILQERPNGSLSPPVNRGILCFASERRICLPCTSFQKQVSSKVNCAWH
AASPFSSSVPTVKLFIDGKFVESQSDKWIDIHNPATNEVIGRVPQSTKAEMDAAVASCKR
AFPAWADTSILSRQQVLLRYQQLIKENLKEIARLITLEQGKTLADAEGDVFRGLQVVEHA
CSVTSLMLGETMPSITKDMDLCSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLM
KPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNRAGEY
IFERGSRHGKRVQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAILVGE
AKKWLPELVERAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGPKEGASILLDGRKI
KVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETETLDEAIKIVNDNPYGNGTA
IFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGFQFYTQ
LKTITSQWKEEDATLSTPAVVMPTMGR
Download sequence
Identical sequences G1U460
ENSOCUP00000024177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]