SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024633 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024633
Domain Number 1 Region: 371-663
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.3e-55
Family YicI catalytic domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 117-178,243-368
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000104
Family YicI N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024633   Gene: ENSOCUG00000001256   Transcript: ENSOCUT00000001256
Sequence length 672
Comment pep:novel chromosome:OryCun2.0:3:146974433:146976466:-1 gene:ENSOCUG00000001256 transcript:ENSOCUT00000001256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAVAARRRRSWAGLVLASLGVCLGIALAVDRSNFKTCEESSFCKRQRRSIQPGLSP
YRALLHTLQLGPDALAVHLIHEVTKVLLVLELQGLQKNMTRISLDELEPLRPRYCVPDVL
VADPPTARLSISGRDDNSVELTVAEGPYKIILTAKPFRLDLLEDRSLLHSVNARGLMGFE
HQRARRVPQGSKDPAEDDEAQPKEMPEDGDKPEETQGKAEKEEPGAWEETFKTHSDSKPH
GPMSVGLDFSLPGMEHVYGIPEHADSLRLKVTEPYRLYNLDVFQHELYNPMALYGSVPVL
LAHNPHRDLGIFWLNAETWVDISSNTTGKTLFGKMLDYLQGSGETPQTDVRWMPESGIID
VFLLLGPSVFDVFRQYASLTGTQALPLLFSLGSHQSRWNYRDEADVLEVDQGFDDHNMPC
NVIWLDIEHADGKRYFTWDPSRFPQPRTMLEHLASKRQKLVAIVDPHIQVDSNYRVHEEL
RNQGLYIKTRDGSDYEGLYWAGSAGYPDFTNPMMRTWWAHMFNFDNYRGSAPNLYIWNGM
NEPSVFNGPEVITFKDAQHYGGWEHRDVHIIYGFYVHMATADGLILRSGGVECPFVLSRA
FFAGSQRFGAVWTGDNTAEWDHLKITVPMCLSLGLVGLTFCGADVGSFFKNSERGLLVRW
YQPFFWAHAHLD
Download sequence
Identical sequences G1U5F4
ENSOCUP00000024633 9986.ENSOCUP00000024633 ENSOCUP00000024633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]