SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024693 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024693
Domain Number 1 Region: 448-738
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-76
Family Protein kinases, catalytic subunit 0.000000271
Further Details:      
 
Domain Number 2 Region: 292-375
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 43-135
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000024693
Domain Number - Region: 151-238
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00314
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024693   Gene: ENSOCUG00000023790   Transcript: ENSOCUT00000025973
Sequence length 918
Comment pep:known_by_projection chromosome:OryCun2.0:13:102275497:102461572:-1 gene:ENSOCUG00000023790 transcript:ENSOCUT00000025973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNNALVFLLSETELSVTAELVPTSSWNISSELDKDSYLTLDEPMNNITTSLGQTAELHC
KVSGNPPPTIRWFKNDAPVVQEPRRLSFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKV
VSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIE
NQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSAVPKPRDLCRDECEILENVL
CQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAASCIRIGIPMADPINKNHKCYNSTGV
DYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE
NFKSDLCDIPACDSKDSKEKNKMEILYILVPSVTIPLAIALLFFFICVCRNNQKSSSPPV
QRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDH
AQLVAIKTLKDFNNPQQWAEFQQEASLMAELHHPNIVCLLGAVTQDQPVCMLFEYMNQGD
LHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAAR
NILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFG
VVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRF
KDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGIAPQ
GQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPPGPPRVIQHCPPPKSRSPSSA
SGSTSTGHVTSLPSSGSNQEANIPLLPHMSMPNHPGGMGITVFGNKSQKPYKIDSKQPSL
LGDSNIHGHTESMISAEL
Download sequence
Identical sequences G1U5L1
ENSOCUP00000024693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]