SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025066 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025066
Domain Number 1 Region: 514-706
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.01e-53
Family Hemopexin-like domain 0.0000000336
Further Details:      
 
Domain Number 2 Region: 110-218,395-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.74e-48
Family Matrix metalloproteases, catalytic domain 0.000000505
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.0001
Further Details:      
 
Domain Number 4 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 2.46e-20
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 5 Region: 335-387
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-19
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 8.95e-18
Family MMP N-terminal domain 0.0000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025066   Gene: ENSOCUG00000016101   Transcript: ENSOCUT00000029140
Sequence length 707
Comment pep:known scaffold:OryCun2.0:GL018725:971854:979002:1 gene:ENSOCUG00000016101 transcript:ENSOCUT00000029140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRQPLVLALLVLGCCSAAPRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASM
HGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRS
YTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYS
ACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSS
CTSEGRRDGRLWCATTSNFDSDRKWGLLPXXXYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEH
PTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYW
RFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGPEVPHVTGALPRAGGKVLLFGHLSSCRFDVKTQTVDSRSGAPVDQMFPGVPLN
THDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPED
Download sequence
Identical sequences G1U6L9
ENSOCUP00000013843 ENSOCUP00000025066 9986.ENSOCUP00000025066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]