SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025210 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025210
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.69e-16
Family Flavin-binding PAS domain 0.0000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025210   Gene: ENSOCUG00000021862   Transcript: ENSOCUT00000031762
Sequence length 113
Comment pep:novel chromosome:OryCun2.0:7:102043417:102045655:-1 gene:ENSOCUG00000021862 transcript:ENSOCUT00000031762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGKVYLFRIPSV
Download sequence
Identical sequences G1U710
ENSOCUP00000025210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]