SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025879 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025879
Domain Number 1 Region: 74-130
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-18
Family Fibronectin type II module 0.001
Further Details:      
 
Domain Number 2 Region: 42-85
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000128
Family Fibronectin type II module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025879   Gene: ENSOCUG00000023495   Transcript: ENSOCUT00000030221
Sequence length 131
Comment pep:novel scaffold:OryCun2.0:GL019267:70918:73080:-1 gene:ENSOCUG00000023495 transcript:ENSOCUT00000030221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPWGAFLFCTCTCSLLQLDPVEAKLLGLVDDSVVTATPDNKCVFPFTFGNKKHFDCID
HPLLHSWCSLSEIYNGKWKYCTDDDRARCVFPFTYKGHVFNSCITLGSVFQMSWCSLSPN
YDQDHAWKYCY
Download sequence
Identical sequences G1U8W1
ENSOCUP00000025879 ENSOCUP00000025879 9986.ENSOCUP00000025879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]