SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026054 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026054
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 8.83e-34
Family VPS28 N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 125-225
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 3.79e-31
Family VPS28 C-terminal domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026054   Gene: ENSOCUG00000022533   Transcript: ENSOCUT00000026281
Sequence length 227
Comment pep:known_by_projection scaffold:OryCun2.0:GL019699:20582:23643:1 gene:ENSOCUG00000022533 transcript:ENSOCUT00000026281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGVPTTPGLGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIEEFCRKFRLDCPLAMERIREDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDPARLHRRFSPDLRELMETMHRMSHLPADF
EGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences G1U9D3
ENSOCUP00000026054 ENSOCUP00000026054 9986.ENSOCUP00000026054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]