SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026231 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026231
Domain Number 1 Region: 72-116
Classification Level Classification E-value
Superfamily LysM domain 0.000000000798
Family LysM domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026231   Gene: ENSOCUG00000025598   Transcript: ENSOCUT00000033182
Sequence length 215
Comment pep:known_by_projection chromosome:OryCun2.0:17:20799886:20820769:1 gene:ENSOCUG00000025598 transcript:ENSOCUT00000033182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLTPAPSLREGGPRAPRASAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVLERRVEHRVRAGDTLQGIALKYGVTMEQIKRANNLFTNDCIFLKKTLSIPIISE
KPLAFNGLNSIDSPENETVDSSFAQEELPVRAGEDLPPPSPQEPDVQPGQPEEVTARDFL
QRLDQQIKLSTQAAKKLKGESRDEESPYATSLYHS
Download sequence
Identical sequences U3KLX3
XP_002717821.1.1745 ENSOCUP00000026231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]