SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026280 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026280
Domain Number 1 Region: 35-156
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.42e-23
Family 4HBT-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026280   Gene: ENSOCUG00000029350   Transcript: ENSOCUT00000033231
Sequence length 161
Comment pep:novel chromosome:OryCun2.0:1:171438014:171588498:-1 gene:ENSOCUG00000029350 transcript:ENSOCUT00000033231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWVSRLLPKNACSFATSSKNQRVEDGRRRQEAYGYFLPIQTRWQDNDQYGHVNNVVYY
SYFDTIINHYLIRYCGLKTCLQTSPLVGFMVTNQCSYHTPISFPQVPVAALAVEKLAEFD
ALACTTGSSVHVFVTPATSKPAGLPEDLRTGLLKLLIPAAA
Download sequence
Identical sequences U3KM22
ENSOCUP00000026280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]