SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026310 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026310
Domain Number 1 Region: 5-361
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.94e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 381-496,615-755
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.02e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026310
Domain Number - Region: 466-610
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00188
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026310   Gene: ENSOCUG00000003845   Transcript: ENSOCUT00000033261
Sequence length 820
Comment pep:known_by_projection chromosome:OryCun2.0:12:89504828:89980395:1 gene:ENSOCUG00000003845 transcript:ENSOCUT00000033261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGP
SHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKW
KTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFD
CSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQV
SSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNR
HKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPAS
GLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRE
LSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDF
SKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEW
YNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIIS
SYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFM
SSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTP
MGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAA
GLVLSVFVAVGEFLYKSKKNAQLEKESSIWLVPPYHPDTV
Download sequence
Identical sequences U3KM52
ENSOCUP00000026310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]