SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026519 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026519
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.96e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.0000000000144
Family YccV-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026519   Gene: ENSOCUG00000007781   Transcript: ENSOCUT00000033472
Sequence length 433
Comment pep:known_by_projection chromosome:OryCun2.0:19:19756666:19770410:1 gene:ENSOCUG00000007781 transcript:ENSOCUT00000033472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCAARRALAVGSRWWSRSLTGARGPRPLCAAWGAGAFLPAATTTTRRHLSSRNRAEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASAAPEKAENPAS
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHWSLGVSNLGPALARRFHGVSREQPPHCVRVVKRDDLESLRWCPGERVLYTAVL
LLGWQLPPDSIPL
Download sequence
Identical sequences U3KMR0
ENSOCUP00000026519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]