SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026554 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026554
Domain Number 1 Region: 260-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-20
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 919-965
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 120-182
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000367
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 14-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026554   Gene: ENSOCUG00000015422   Transcript: ENSOCUT00000033507
Sequence length 1398
Comment pep:known_by_projection chromosome:OryCun2.0:2:173799895:173900751:1 gene:ENSOCUG00000015422 transcript:ENSOCUT00000033507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEAARRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPTITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSVPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSARVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVANVALNQGQASSQGSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLTTRSRMPNNSFPPNIPSLNSPVGMTSSACNNSNRSYSNIPVPS
LQGMNEGPSNSVGFSANSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNSDRLSDGDSKYAQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
SGTSNSGSANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASACVS
VTGQAQGSAGIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MEPCNTNPAAMTKPAPEEIKLESQTQFTADLDQFDQLLPTLEKAAQLPGLCEPDRMDGAV
TSVTIKSEILPASLQSTTARPTSRLTRLPELELEAIDNQFGQPGTGDQIPWANNTVAVNQ
NKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLV
QGGGLDVLSDRFPPQQAAAPLMMEERPNLYSQPYSSPSPTASLPSPFQGMVRQKPSLGTV
PVQVTPPRGAFSAGMGMQPRQTLSRPPAAPNQLRLQLQQRLQGQQQLIHQNRQALLNQFA
ATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFG
NNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYATNPGTPPASTSPFSQLAANPEASLANR
NSMVNRGMAGNMGGQFGTGINPQMQQNVFQYPGSGMVPQSEANFAPSLSPGSSMVPMPIP
PPQSSLLQQTPPASGYQSPDMKAWQQGAMGNNNVFSQAVQNQPAPAQPGVYNNMSITVSM
AGGNTGVQNMSPMMGQMQMSSLQMPGMNAVCPEQINDPSLRHTGLYCNQLSSTDLLKTEP
DGTQDKKTEEFFSVVTTD
Download sequence
Identical sequences U3KMU5
XP_008253028.1.1745 XP_008253029.1.1745 ENSOCUP00000026554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]