SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026754 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026754
Domain Number 1 Region: 320-582
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.85e-81
Family Eukaryotic proteases 0.00000000935
Further Details:      
 
Domain Number 2 Region: 126-232
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 235-320
Classification Level Classification E-value
Superfamily Kringle-like 1.12e-30
Family Kringle modules 0.0000226
Further Details:      
 
Domain Number 4 Region: 57-106
Classification Level Classification E-value
Superfamily FnI-like domain 4.18e-18
Family Fibronectin type I module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026754   Gene: ENSOCUG00000009967   Transcript: ENSOCUT00000033707
Sequence length 584
Comment pep:known scaffold:OryCun2.0:GL018706:1095242:1117621:1 gene:ENSOCUG00000009967 transcript:ENSOCUT00000033707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWWSPAADRTPAAVCRDAEMWNPGVRELLCVLLLCGAACARPSQEAPARVRRGARSFRV
TCVDQQTQLTYQRRESWLRPGLRGNRVEYCRCSSGGPRCHSVPVQSCSEPRCLNGGTCSQ
ALYFSDFVCQCPEGFVGKRCEVDTRARCYEDRGIGYRGTWSTTESGAQCVNWNSSWLALK
PYSGRKPNALRLGLGNHNYCRNPDRDTKPWCYVFRAGTYSPEFCSTPACSKEKNGNCYLG
KGQAYRGTHSLTTSGASCLPWNSMLLVGEKYTARQSNAEALGLGKHNYCRNPDGDSKPWC
HVLKNRKLVIEYCDVPQCATCGLRQDKQPQFRIKGGLFTDITAHPWQAAIFTNNRRSPGE
RFLCGGILINSCWVLSAAHCFLERFPQQKLRVILGRTYPLVSAEEEQIFEVEQPILHERF
DEGTYDNDIALLKLKSTSGSCAQESQAVRLVCLPDASLQLPDWTECELSGYGKHEEFSPV
FSEQLKEAHVRLYPSSRCTPQQLKNRTVTGNMLCAGDTRSGGAQVNLHDACQGDSGGPLV
CMTDGHMTLIGIISWGLGCGQKDVPGVYTKVVNYLGWIQQHVGP
Download sequence
Identical sequences U3KNE5
ENSOCUP00000026754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]