SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026799 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026799
Domain Number 1 Region: 86-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000038
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026799
Domain Number - Region: 447-488
Classification Level Classification E-value
Superfamily Prefoldin 0.0471
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026799   Gene: ENSOCUG00000029659   Transcript: ENSOCUT00000033752
Sequence length 542
Comment pep:known_by_projection scaffold:OryCun2.0:GL018731:1102863:1150093:-1 gene:ENSOCUG00000029659 transcript:ENSOCUT00000033752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGDRENENADVPGRPERRKKERIKSFFSELRAMMKSQGYPTKGDRYKAPMNDIAVSQL
KGIIKSSWMPRFRNYEEFNQMTLQSLDAFMVILSTDGLIIYVSENISPLLGYLPEEIVGK
KLLHLLHDEEKNEVYQKIALKLPMSNSVEKHIEFGCYLKRGDTEHDAYEYAKFILDVKDI
ALQSEPFALFAAHIPTSYYDAPTNSTLPWEDRIYLVGMICIIRNKILKELYDNRYFNREV
LLTQDSEGEHAPWNTRSAQGQRRGSRFQTLRDKAAASNDETGLVAVQQYGSQEVEVIKIE
SDSSYDSKTSSDSPAQSWQSFGYESEVDPEKLKDPVDLEYSVSLEEAGDLDNSVDTENLN
NTVETVAPEVKENSAGQSEPEYVDDSADSEIPVVQEVLSVDDSADSEIPVVQEVLSAATV
FAGSSAQPVSLPMVSYTNGHELHLMKTFKEQLEDRTRVLQADITSKQDALDMMKEQLQTL
QDSTYQMQSTTFVVSPESKTQCTAQMKRSFSDVQEAKRFCGPSRSLTSTNMFDDHTITSN
QV
Download sequence
Identical sequences U3KNJ0
ENSOCUP00000026799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]