SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027117 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027117
Domain Number 1 Region: 1529-1832
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000341
Further Details:      
 
Domain Number 2 Region: 1830-2115
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.68e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000144
Further Details:      
 
Domain Number 3 Region: 1-148
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.88e-37
Family Carbonic anhydrase 0.00028
Further Details:      
 
Domain Number 4 Region: 157-257
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000014
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027117   Gene: ENSOCUG00000013209   Transcript: ENSOCUT00000034068
Sequence length 2148
Comment pep:known_by_projection chromosome:OryCun2.0:7:22664822:22755004:-1 gene:ENSOCUG00000013209 transcript:ENSOCUT00000034068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIYCFDVDRFSSFEEAVKGKGKIRALSILFEVGIEENLDYKAIIDGVENVSRFGKQAAL
DPFILLNLLPNSTDKYYSYNGSLTSPPCTDTVEWIVFKDTVSISESQLAVFCEVLTMQQS
GYVMLMDYLQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPENYTSLLVTW
ERPRVVYDAMIERFAVLYQQLEGNDQTKHEFLTDGYQDLGAILNNLLPNMSYVLQIVAIC
TNGLYGKYSDQLIVDMPADDAELDLFPELIGTEEIIKEEESRKEDIVVNPGRDSATNQIR
KKEPHISTTTHYNRIGTTSNEAKTNRSPTRGSEFSGKGDIPNTSSASTSQAVADLATEKA
TSLTSEPVTELPPHTVEGPSASLNDDSKADVRYPQMNLSGTAESLQTVSITDYPEVSTDI
GEEESLLTSFKLDSGSDDSSGSSPATSAMPFVSENISHVYIFSSENPEAITYDILIPEST
SKTSEDSVSSGSEESLKDPSGDRNGWLPSSTYVPAQPDGGSGRESFLQTNYTEIPIDEPA
QTTESPSPGPQGPLVTDVEMPAYSTFAYFATEATPHAFTPSSGQRDSVPTVHVVHSQTTQ
PVYNGETPLQPSHSSEVFPLVTPLLLDNQILNTTPAASSSDSALHATPVFPSVDVSFEPI
LSSYDGAPLLPFSASFSSELFRHLHTVSQILPQGTSATDSDQVPLHASLPVAGGDVLLEP
SLAQYSDVVSHQTTAHAASETLESGSESGVLYKTHLFSQVEPSSSDVMMHARSSGPEPSY
ALSNHEGSQHFFAVSYSSAIPVHDSVDVSDQGSLFSSPSRVSISKSSLITPTASLLQPTH
ALSGDGEWSGASSDSEFLVLDTDGLTAPNVSSPVSVAEFTYTTSVFGDGNKPLSKGEIIY
GNETELQISSFSEMVYHSKRTAVPETSVSMSSTKGMLPGSPAYTTPKAFEREVSQVQPTH
TTSPAFGDPSLKLVLSANSEPTSSDPASSEMLLPSTQLLFYETSASFNPEVLLQPSFQAS
DVDNMLKTATPTVPTDSVKVETPKVDNIGSAMLHLMASDSAASENMLHATSVPVFDVSPT
SNMYSASLQGITYASEKYFEPVLLKSKSSQQIITSSYSIDELFQTTNLESNQAFPPQGSH
AFATPILSVDEPPNSLITKLVYSDELSTSTTSSITDGVFTGIPTVASGTLAPTDPSVSLG
NEHVSITAVSPNQDGSVGTTKLLFPSNASFGLSSSARTVADLVGGGEDGDTDDDYGDDDD
DDYDDRESDGLSISKCMSCSAYRESQEKVMNESDTQENSPEDQNNLLSYSQPATSDEGNK
VTGVTSDSQTGMDRRPDKSPPASVLPAKHNGKEDSDTQTGRAPLPLSPESKAWSVLTSDE
ESGSGQGTSDSFSDNETSTDFSFPDANERDIDGVMEAGDSELTPKSPRPSTPSVTNGHSE
VFNISEAEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVALVGILIYWRKCFQ
TAHFYLEDSTSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASNGFTEEFETLKEF
YQEVQSCTADLGITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANY
VDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSE
EYGNFLVNQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEF
SLPVLTFVRKAAHAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKH
IRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDTHIHAYVNALLIPGPTGKTKLEKQF
QLLSQSNIQQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYY
QSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESF
KVSLMAEEHKCLSNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISI
IKEEAANRDGPMIIHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFA
DIEQYQFLYKVVLSLVSTRQEENPSTSLDSNGVALADGNMAESLESLV
Download sequence
Identical sequences U3KPF7
ENSOCUP00000027117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]