SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000165 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000165
Domain Number 1 Region: 216-460
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 2 Region: 88-281
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000111
Family Tropomyosin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000165   Gene: ENSOCUG00000000187   Transcript: ENSOCUT00000000187
Sequence length 559
Comment pep:known_by_projection chromosome:OryCun2.0:4:90180057:90191587:1 gene:ENSOCUG00000000187 transcript:ENSOCUT00000000187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGAVARGGVGXHGAASPWEKGAHQSGGGDNVGKQQQHPPQHPQNQAHGKSSSASCSRRL
GRALNFLFYLALVAATAFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQS
LQATFGTFESILRSSQHKQDVTEKAVKQGESEMNRISEVLQKLQNEILKDLSDGIHVVRD
ARERDFSSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDVKAKVASLEESEGYKQ
DLKAVKAAVKEMQASAEARERDVEALRSSLQAVEADVYTEVRELVSLKQEQQAFKEAADK
ERLALQALTEKLLQSEESVSHLPDEVRRLEEELQQLKADARRPEEDGGFRSSGALEALQE
KSQGLDSRLQTVEDGVHAVQVAAAHQTESLESLLSKSQEHEQRLGALQQRLEGLGASPEA
DKDGLASTVRSLGEAQLALYTDVEELKRSMGELPSTLESLQKVQEQVHTLLGQDRPQAAP
LPPQDVLDRLSSLDNLKSSVSQVESDLKMLRTAVDSLVAYSVKIEDNELNVRSAKGLLDD
LRKDVDRLFVLVEKIYEKI
Download sequence
Identical sequences G1SCT0
ENSOCUP00000000165 9986.ENSOCUP00000000165 ENSOCUP00000000165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]