SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004728 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004728
Domain Number 1 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.55e-17
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 90-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000685
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 286-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000191
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004728   Gene: ENSOCUG00000005451   Transcript: ENSOCUT00000005450
Sequence length 424
Comment pep:known_by_projection scaffold:OryCun2.0:GL018949:289392:296478:-1 gene:ENSOCUG00000005451 transcript:ENSOCUT00000005450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEQTAALGTRWESMNAQLDGAQSHVERRSQEEGPWRTSPGPLEHLCCDLEEEPQSLQE
KAQSAPWVPAIPQEGSAGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFY
GEYVMQENCGIVVSLRFPIPKLDMLSQVEGGEEQWVPDPQDLEERDILRVTYTGDGSEHE
GDTPELEADPPRMFSSVSEDTVLWNPEQDDSWDSMPRSSRGTLLGPHFLQEDSFSNLLCS
TEMDSLLRPHTCPQCGKQFVWSSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQKTH
LHDKPSRCSECGKNFRCNSHLASHQRVHAEGKSCKDQGGDDSPGAMKRQRALPVPKCHVC
TECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQNPRSSWDRG
TSVF
Download sequence
Identical sequences G1SNY6
ENSOCUP00000004728 XP_008250087.1.1745 XP_008250091.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]