SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005578 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005578
Domain Number 1 Region: 914-1206
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.47e-85
Family Complement components 0.0000236
Further Details:      
 
Domain Number 2 Region: 1287-1415
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.11e-31
Family Alpha-macroglobulin receptor domain 0.0017
Further Details:      
 
Domain Number 3 Region: 750-803
Classification Level Classification E-value
Superfamily E set domains 0.0000000063
Family SVA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005578   Gene: ENSOCUG00000006444   Transcript: ENSOCUT00000006452
Sequence length 1453
Comment pep:known_by_projection chromosome:OryCun2.0:12:60546042:60712350:1 gene:ENSOCUG00000006444 transcript:ENSOCUT00000006452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPPLLTAAHLLCLCCAAVAAAPRPRFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKA
ELFKMASNLNVSVLEAEGVFDKGSFRTLTLPSIPLNSADEMYELRVTGRAQNEILFSNST
RLSFETKRISVFIQTDKALYKPAQEVKFRVVTLFSDFKPYKTSLNILLKDPKSNLIQQWL
SQQNDLGVVSKTFQLSSHPIVGDWSIQVQVNDQTYYQSFHVSEYVLPKFEVVLQTPLYCS
LNSKNLNGSITANYGYSLNIFPDSSMTKVYIPNQKFAFWNEPTTIVLCVDHKQFRNFSEN
VNSKLKTFVSEMNNLKNYLCLRVLEIILNVAISKIGISRNASSNVFFKQHDYIIEFFDYA
AVLKPSLNFTATVKVARSDGHQLTPEERSNNVVIAVLQRNSTNLWTRWSSRNEETAAVQN
ISYALPPSGIFTIEFPILDNSAELQLKAYFLDSVSSMAVHGMFTSPSKTYIQLKTRDENV
KVGSPFELVVTSNKPLKELSYMVVSRGQLVAVGKQNSTIFSLTPESSWAPKACIIVYYIK
DDGEIINDVLKIPVQLVFKNEIKLFWSKASAKPSEKVSLKVSVTQPDSIIGITAVDKSVN
LMNASNDMSVENVRHLTQLFFRICFFFFNLHINTFLIFHSTFVLFSLVNANINKKYIQHL
YDNDTLEYAERFVEENDGNMVDIHDFSSVDYPHVRKHFPETWIWIDTHMGSKTDQEFEVT
VPDSITSWVANAFVISEDLGLGLTTAPVELQAFQPFFIFLNLPYSLIRGEEFALEVTIFS
YLKDAIEVKVIIEKSDKFDILMTSSEINATGHQQTILVPSEDGATVVFPVRPTQLGEIPI
TVIAVSPSASDAITQRILVKAEGIEKSYSQSILMDLTDPKLRSTTKTWSFSFPPDTVSGS
ERVQIKCTRDILGPSISGLASLIQMPSGCGEQNMINFAPNIYVLDYLMKKRQLTDNLREK
ALAFMRQGYQRELLYQREDGSFSAFGNVDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHR
TYTWLKGHQTRNGEFWEPGRVIHSELQGGNNSPVTLTAYIVTSLLGYKKYQPNIDVQDSV
SFLESQLDREVSDNYTLSLITYALSSVGSPRAKEALNVLTQRAEQEEGMRFWVSSVSKLS
ESWQPRSLDIEVAAYALLSHFLQHQVAEGIPVMRWLSRQRNSLGGFASTQDTIVALKALS
EFAALMNTERTDIQVTVMGPSSPSPTKFLIKTHSRLLLQSAELPVEQPTTVNISANGFGF
AICQFNVIYNVKESGSARRRRSIQNEEAFDLDVDVEDNKDDINRVNLNVCTRFLGPDRSG
MALMEVNLLSGFTVPSDAVPLSETVKKVEHDHGKLSLYLDSVNETQFCVDIPAVRNFKVS
NTQDALVSIVDYYEPRRQVVRSYNSKAKLSSCDLCRGVQGCRPCEDGAAACLHHSPLLFV
FCVLLLCSLQYWL
Download sequence
Identical sequences G1SR15
9986.ENSOCUP00000005578 ENSOCUP00000005578 ENSOCUP00000005578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]