SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005957 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005957
Domain Number 1 Region: 274-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000649
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000856
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000005957
Domain Number - Region: 172-205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0902
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005957   Gene: ENSOCUG00000006891   Transcript: ENSOCUT00000006889
Sequence length 414
Comment pep:novel chromosome:OryCun2.0:19:45409330:45410574:-1 gene:ENSOCUG00000006891 transcript:ENSOCUT00000006889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVPATLLLWAWGHLQAFEIVEKENIFQKTPCPAFLMFDNAAYLADMSFELPCHCKPEE
VLAVVWYYQKRLGSSHTTVLTDFDGRVLTEAAHVRTGSDVLQRFSIRMFSLLVFRAQPQD
SGLYFCGTRKGDYFYAYDVDIQSSEGMVATFQDKGEEPLADEFRGSLRVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPGLSPRYRKSVPDVVSCGSRAVPRKLRAAARDHTPEVLVRSC
QEPCTMRKTIRGGVLAIYNYVSKLGSRPWVPQVPIQFHQQRLGHGLVISCPGARPEHAVA
WDKDNQRLYRTEYLKGANRSMRVFIDHGSHLHIRFTQLSDRGIYYCWRQGERVAGFRLGV
TTRGRSPASLSDPETRAAVELTLIGYVLITLLFVSIHLCRCCCYLLRCCPSFSP
Download sequence
Identical sequences G1SRX5
ENSOCUP00000005957 XP_002719489.1.1745 9986.ENSOCUP00000005957 ENSOCUP00000005957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]