SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006009 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006009
Domain Number 1 Region: 253-532
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-85
Family Ku70 subunit middle domain 0.000000000591
Further Details:      
 
Domain Number 2 Region: 33-252
Classification Level Classification E-value
Superfamily vWA-like 1.38e-60
Family Ku70 subunit N-terminal domain 0.00000000638
Further Details:      
 
Domain Number 3 Region: 559-607
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000549
Family SAP domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006009   Gene: ENSOCUG00000006948   Transcript: ENSOCUT00000006949
Sequence length 608
Comment pep:known_by_projection scaffold:OryCun2.0:GL018734:848359:877649:-1 gene:ENSOCUG00000006948 transcript:ENSOCUT00000006949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWESYYKTEGDEEVEEEEESPEAGGEYKYSGRDSLIFLVDASRAMFESQSEDELTPFD
MSIQCIQSVYTSKIISSDRDLLAVVFYGTKKDKNSVNFKNIYVLQDLDNPGAKRMLELDR
FKGQEGKEHFQDLIGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHGDDSA
KASRARTKASDLRDTGIYLDLMHLKKRGGFDISLFYRDIISIAEDEELGVYFEESSKLED
LLRKVRAKETRKRVLSRLKFKLNKDVVFSVGIYNMVQKATKPMPVRLYRETNEPVKTKTR
TFNVNTGSLLLPSDTKRSQIYGSRQIVLEKEETEELKRFDEPGLILIGFKPLVLLKKHHF
LRPSLFVYPEESMVNGSSTLFSALLTKCLEKEVLAVCRYTPRKNVPPYFVALVPQEEEVD
DQKIQLTPPGFQLVFLPYADDKRKVPFTDRVLANPEQVDKMKAIVQKLRFRYRSDSFENP
VLQQHFRNLEALALDLMEPEQAPDLTLPKVEAMSKRLGSLVDEFKELVYPPDYNPEGKAT
GRKQDDEGSRSKRPRVELSDEELKAHVSKGTLGKLTVPVLKEACRAHGLKGGLKKQELLD
ALTRHFQD
Download sequence
Identical sequences G1SS22
9986.ENSOCUP00000006009 ENSOCUP00000006009 ENSOCUP00000006009 XP_002721433.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]