SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006025 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006025
Domain Number 1 Region: 434-922
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-165
Family ALDH-like 0.000000000676
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 1.31e-49
Family Formyltransferase 0.0000000172
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.04e-25
Family Post formyltransferase domain 0.0000155
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006025
Domain Number - Region: 346-417
Classification Level Classification E-value
Superfamily ACP-like 0.0016
Family Acyl-carrier protein (ACP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006025   Gene: ENSOCUG00000006962   Transcript: ENSOCUT00000006965
Sequence length 923
Comment pep:known_by_projection chromosome:OryCun2.0:4:91263358:91325818:1 gene:ENSOCUG00000006962 transcript:ENSOCUT00000006965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGGGQALRRFSSSPISFKNKLKLALIGQSLFGQEVYNHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDGP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGLSVFWADDGLDTGPILLQRSCEVQPND
TVDTLYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
YGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKLIWAGILSNVP
VIEDSTDFFKSGARSMDVVRLVEEIRQKCGGLQLQNEDVYLATRFEDFIQKVVRKLRGED
QEAELVVDYVSKEVNEMTVKMPYQCFINGEFTDADDGKTYDTINPTDGSTICKVSYASLV
DVDKAVAAAKEAFENGEWGRMNARERGRLMYRLADLLEEHQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences G1SS37
ENSOCUP00000006025 XP_002711492.2.1745 ENSOCUP00000006025 9986.ENSOCUP00000006025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]