SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006861 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006861
Domain Number 1 Region: 24-488
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-177
Family ALDH-like 0.00000000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006861   Gene: ENSOCUG00000007938   Transcript: ENSOCUT00000007940
Sequence length 489
Comment pep:known_by_projection scaffold:OryCun2.0:GL019481:21:32016:-1 gene:ENSOCUG00000007938 transcript:ENSOCUT00000007940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDKKAPVLPRPVRNLEVKFTKIFINNEWHQSKSGKKFATYNPSTLEKI
CDVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLQQLADLVERDRAVLATLETM
DTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQGRTIPTDDNVLCFTRHEPVGVCGAITPW
NFPLLMLVWKLAPALCCGNTVVLKPAEQTPLTALHLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYPEFVKRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFNKILELIESGKQEGAKLECGGSAVEDRGLFITPTVFSEVTDSMRIAKEEIFGPVQPIL
KFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGREL
Download sequence
Identical sequences G1SU45
ENSOCUP00000006861 9986.ENSOCUP00000006861 ENSOCUP00000006861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]