SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006909 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006909
Domain Number 1 Region: 39-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000471
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006909   Gene: ENSOCUG00000007996   Transcript: ENSOCUT00000007994
Sequence length 208
Comment pep:novel chromosome:OryCun2.0:X:33136135:33146205:1 gene:ENSOCUG00000007996 transcript:ENSOCUT00000007994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKINDTETTSLQDETVPGSMSTNGSLPMSHSADSQKSEKTCKAFKDISQYFSKKEWEKLE
YSEKITYVYMKRNYTTMTKLGFKTVVPAFMCSGRNAEKSQEDDPDAGQGVSTAGRDAPVP
ESSGMHQRKHLKVTKKPAKRRNNSRGMPRTSYSGQAKKKRNLEHLSTSGEHDVVSEPRKK
EINVWSHRLRERKYVVAYEEISDPEEED
Download sequence
Identical sequences G1SU88
ENSOCUP00000006909 XP_008270790.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]