SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008062 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008062
Domain Number 1 Region: 899-1074
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 483-599
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.11e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1160-1306
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-18
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 4 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000013
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 
Domain Number 5 Region: 370-475
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000591
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 6 Region: 597-778
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000105
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 284-327
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000171
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 8 Region: 793-892
Classification Level Classification E-value
Superfamily PH domain-like 0.00000042
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1117-1180
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000346
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008062   Gene: ENSOCUG00000009340   Transcript: ENSOCUT00000009342
Sequence length 1524
Comment pep:known_by_projection chromosome:OryCun2.0:3:23712562:23737910:-1 gene:ENSOCUG00000009340 transcript:ENSOCUT00000009342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELRQLGVNATGHRKRILR
LLQAGSAEGSLDPKSDSTMEPSPSLDAPAQTPKPVPKPRTVFGGLTGPATTQRPGPSPTF
RGPEVSRSPESSPKSPPLPTSSSGQPSSSDMVEMMPNAIYFGLDLRGGAQAAQDMAPDSS
QKAAPTPALRPATGTVHIMDPGCLYYGVQPVGAPGATDRREGRGVCQDRAEHRLSRQDLE
AREDAGYASLELPGDSTLSLPTLDTEETSDDLISPYASFSSTADPPTPLLSGWLDKLSPQ
GNYVFQRRFVRFNGRSLMYFGSDKDSFSRLARSGLEGGSPRERMARLPTVLSPPPPPAQR
DTWCSTLQSCLKELHLLGSPRPPQLPRPLRTGMLELRGHKAKVFAALSPGELALYKSEQA
FSLGIGICFIELQGCSVRETKSRGFDLLTPHRCFSFTAESGGARQSWAAALQEAVTETLS
DYEVAEKIWSNRANRHCADCGAPRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLD
TSVWSNEIVQLFITLGNDRANRFWAGALPPGEGLHPDSTPGSRGEFISRKYRLGLFRKSH
PQCPDHGQLLQALCAAVAGPNLLKNMTQLLCVDATEGEESWSPSALNGSCPGLLPSDPSP
GVYNEVVVPATCSSFLYCGPVSNKAGPPPPRRGRDAPPRLWCVLGAALEMFASESSSEPL
SLIQPQDVVCLGVSPPPADPGDMDRLPFSFELILTGGRIQHFGTDGADSLEAWTSAVGKW
FSPLSCHQLLGPGLLRLGRLWLRSPSHTALAPGLWLSAFGLLRGDHLFLCPEDMVHLRRL
QEISVVPAADTPDKKEHLVLVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQM
SRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVE
DVTDTLKRFFRELDDPVTCARLLPRWREAAELPQKNQRLEKYREVIGCLPRVNRRTLAAL
IGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYVCVFDIDADQ
VAQIELEVNLITTWKDVQLSQAGDLIMEVYLEQQLPDNCVTLKVSPTLTAEELTNQVLEM
RGTAAGTDLWVTFEILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSLARAS
CLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLKEKKSSKPEREWPLE
GAKVYLGIRKKLKPPTPWGFTLILEKLHLYLSCTDEDEMWDWATSILKAQHDDQQPVVLR
RHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEE
QEEVEEPVYEEPVYEEVGAFPELTGDTLSSFSSTQEWAATPDTPLTSQRSFDQPPASKAN
TLGQEEGPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGDTTACLGSPPPPSPTGP
PPQTPGFPTHSPHSSSLPSSQPFT
Download sequence
Identical sequences G1SX12
ENSOCUP00000008062 ENSOCUP00000008062 9986.ENSOCUP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]