SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009159 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009159
Domain Number 1 Region: 405-793
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.97e-131
Family Ankyrin repeat 0.000000000362
Further Details:      
 
Domain Number 2 Region: 161-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.63e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 8-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-55
Family Ankyrin repeat 0.0000175
Further Details:      
 
Domain Number 4 Region: 3484-3585
Classification Level Classification E-value
Superfamily DEATH domain 5e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009159   Gene: ENSOCUG00000010618   Transcript: ENSOCUT00000010629
Sequence length 3871
Comment pep:known_by_projection chromosome:OryCun2.0:15:36032556:36234365:-1 gene:ENSOCUG00000010618 transcript:ENSOCUT00000010629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG
SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVK
YLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKS
AALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI
TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLA
RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK
RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV
LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRL
GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPL
HVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAK
NGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN
IHMSTKSGLTSLHLAAQEDKVNVAEILTKHGADKDAHTKLGYTPLIVACHYGNVKMVNFL
LKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYI
SVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDL
KELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAMIDDTVV
IPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHN
GLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCEYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPVYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDEGRVQASQSERELVEEDWVIVSEEEIEEARQKAPLEVSEYPCVEVR
IEKEPKVKAEKDPTGLVSYLTEDLNSYESSREEPRQMEQDTTGEQSEAVVMDRSSANGGK
DVSSEETQATQKQHKPSLGIKKPVRRKLKEKQKQKEEGLPANADKTELKKCSSEESLDED
AGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKK
TVHRTHPVVSPSLKSERHAPTSPSSKTERHSSLSSSAKPERHTPLSPSGKTERHSPVSSG
KTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKVDKRPPVSPSGKTERHPPVSPGRT
EKRLPVSPSGRTEKHPPLSTAGRTEKHLPVSPGKTEKQPPVSPTSKTERIEETMSVRELM
KAFQSGQDPSKHKTGLFEHKAAKQKQPQEKGKVRGEKEKGQPITQRETQKTESQTSKRGQ
RFTVTGVSEPKRGIRTSSIGFKREDTAGEKEKAIGPKTPEPVQSAAEEESQRESDIPKEK
MAEEQGDMDLQISPDRKTSTDFSDVIKQELEDNDKYQQFCLSEETEKAQLHLDQVLTSPF
DTTFPLDYMKDEFLPVLSLQSSAMDGSSESLKHEGIIGSPCGSLMEGTPQISSEESYKHE
GLAETPETSPESLSFSPKRSEEQTGETKESTKLAMPSEIISEREHPTTQNVTACSEGPGS
TVTEDSEPSPECLQEKATPDTSKDTCPKQESDCSDSSSLTLARETPHALTEEASHDANHL
TFGGSTHKTQTDTETQESSVPSDETKSPPDASAKADTGTESKPQGVIRSPQGLELALHSR
DSEVLSPMADESLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEP
KMKAGVLPSHFPLPAAVAKTELFTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPL
SPDTPSSEEVSYEVTPKTTDTSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIK
MFDELEQEAKQKRDCRKEQKQEESPSSSDPDADCSADMDEPKPMESVDGESDVPVLVTSE
SRKTSSSSESEPELTQLKKGADSGLLQEPVIRVQPPSPLPSSIDSNSSPEEVQFQPIATK
QYTFKMNDDTQEEARTSEEEKDCETHFTEDSHTVSTSDTHRSDDDLNRDTDKPKTCDGHG
CEALSPNGSATPTSGGLQSETGDDINEQLALRKEALALHDTHEEAVLGEELDASVVESPQ
GDFPRDNSSSLSSLPHCSGSEGKELGEDLSPTLATTKVEVVKTDQAFESLSMDCSTQDSS
MTMQAERFSMDGPVSDLTETDEIFDPQIISPYENVPPQSFFCSEESKVQTDESHTTSSHS
SAVCSVTITSSVEEVVVGSSSRVVSGKESNIESQKIEIETKQENTMGELQPGKSSSSSEP
SMPNTPAVNVEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQG
TTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQE
SREEMLSEDIKEGTTVVEPPQAETSAGSLALSESKEMGDDEADLVPDDLSEEAEEVPASD
TQLSTQMGISTATEMTTEKDISTGTEDLPTMQMEDVPPLSSRPDSPEPVVQVQLDFSTVT
RSVYSGRDDDSPDSSPEEQKSVIEIPTASMENVPSTESKSKIPVRTVPTSTPAPPSVENE
SSVSEEFLSSLDEEKKEDEAKPKSKIPIKAPIQRVEQQLSHADLSLQKTAVPQGQDMTSR
APDNRSKSESDEGPLDSEIRCPVINRSYTETEAEGREGAEELELESEEGATKPKIFASRL
PVKSRSTASSGREGVSPTKESREHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQELV
SDDESSSALEVSVIENLPAVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDP
QDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLE
RDGKHATDTSLIECLTKINRMDIVHLMETSTEPLQERISHSYAEIEQTITLDHSEGRFSV
LQEELCITQHKQKEEQAVSKDEPRDHPPIVSEEDISVGYSTFQDYIPKTEGGGSVTTLSP
QTPKEQVHQDFSGKTQDLPEEPSLEYQQEYFVTTPGTEVSESQPAAPIRSSPWQTPEEMG
TPLEEERPYLQTPTPSERGGSPIVQEPEEPPEHREESPRKTSLVIVESADDEEENCRLLG
QFSKGDDMPDLPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSDGIEKEEITVQGVPQE
PVGITEGDSYSKVIKRVVLKSNIEQSENNHE
Download sequence
Identical sequences G1SZP4
ENSOCUP00000022575 9986.ENSOCUP00000009159 ENSOCUP00000009159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]