SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012580 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012580
Domain Number 1 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 356-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 524-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 565-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 151-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000388
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 190-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000495
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012580   Gene: ENSOCUG00000014634   Transcript: ENSOCUT00000014632
Sequence length 638
Comment pep:known_by_projection scaffold:OryCun2.0:GL018881:251974:268285:1 gene:ENSOCUG00000014634 transcript:ENSOCUT00000014632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLKEAVTFQDVAVVFTKEELRLLDAAQRALYRAVMLENFRNLLSVGGKNLNEMEVGLR
HLPREEVFRSQTWQQFTVELAGCQDFLAGIQRTGTELKNQRDTLDKDGEFSEGWNQSSQL
HAQYRVHAGEKPPGGEDRAEGLSWHCRLPIRQRAHAGEKPYPCEKCGDAFRRHSSLQAHQ
RAHSRERVSQRSQSRRQQRVPTGEKPATCGECGRNPGKLSSCQVPLTVHTGEKLHTCEAC
GVGRSQHSCLQGRRRGHAGTKPYSCEECGKGFSWRSRLQAHQRIHTGEKPYRCDACGKGF
SYSSHLHIHCRTHTGERPYQCAECGKAFSVGSHLQAHQVSHTGEKPYRCEECGKGFCRAS
NLLDHQRGHTGEKPYQCDVCGKGFSRSSDFNIHFRVHTGEKPYRCEECGKGFSQASNLLA
HQRGHTGEKPYKCATCGKGFSRSSDLNVHCRIHTGEKPYKCEKCGKAFSQFSSLQVHQRV
HTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHCGVHTGE
KPYRCDVCGKRFRQRSYLQAHQRVHTGEKPYKCEECGKVFSWSSYLQAHQRVHTGEKPYR
CEACGRGFSWSSSLVIHQRVHADGEGDKDFPSEGAPRK
Download sequence
Identical sequences G1T7S9
XP_008249497.2.1745 ENSOCUP00000012580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]