SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013246 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013246
Domain Number 1 Region: 196-273
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.22e-18
Family Middle domain of MutM-like DNA repair proteins 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000013246
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0188
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013246   Gene: ENSOCUG00000015419   Transcript: ENSOCUT00000015416
Sequence length 334
Comment pep:known_by_projection chromosome:OryCun2.0:2:38191800:38209597:-1 gene:ENSOCUG00000015419 transcript:ENSOCUT00000015416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPSVRKFHHLVSPFVGQQVVKTGGSSKKLHPPDLQSLWLQDTQVHGKKLFLRFDPDE
ELRLRGNDPLPEPLRKGAQEVEAADQEQAVGPSRQTASDKSSQAAALAVPPGDEGPKCLG
ADCLTPGAERWLQVSFGLFGSIWVNEFSRAKKANKRGDWRDPAPRLVLYFGGGGFLAFYN
CQMSWSSSPVVRPTSDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEVLY
RAGVHPLSLGSLLSPSCLEALVDHVVEFSTHWLQDKLQGRQQHPQIYQKEQCPAGHQVLK
QELGPPGGFQRLTWWCPQCQPRLPAEGPEQHQRA
Download sequence
Identical sequences G1T9E1
ENSOCUP00000013246 9986.ENSOCUP00000013246 XP_002709338.1.1745 ENSOCUP00000013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]