SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016410 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016410
Domain Number 1 Region: 218-510
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.01e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 25-206
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.22e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016410   Gene: ENSOCUG00000025433   Transcript: ENSOCUT00000029998
Sequence length 595
Comment pep:known_by_projection chromosome:OryCun2.0:1:185198348:185231814:1 gene:ENSOCUG00000025433 transcript:ENSOCUT00000029998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAVGPAAAAVPAPAASANGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDP
WFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPTDVFPRLFKEWGVTRLTFE
YDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISR
MELPKKPAGSVTSQQLEGCRAEIQDNHDETYGVPSLEELGFPTEGLSPAVWQGGETEALA
RLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRN
STPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPW
IDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMW
LSCSAFFQQFFHCYCPVGFGRRTDPSGDYVRRYLPKLKGFPSRYIYEPWNAPESVQKAAK
CIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSS
SQAGSVSGAAPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAEVPTPELPSKAV
Download sequence
Identical sequences G1THJ9
XP_008268424.1.1745 ENSOCUP00000016410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]